PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_53427_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family TALE
Protein Properties Length: 325aa    MW: 36858 Da    PI: 5.0562
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_53427_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox277.7e-092673022055
                                           HHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
                              Homeobox  20 eknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                                           +k +yp+++++  LA+ +gL+++q+ +WF N+R ++
  cra_locus_53427_iso_1_len_1052_ver_3 267 YKWPYPTEADKISLAETTGLDQKQINNWFINQRKRH 302
                                           4679*****************************885 PP

2ELK21.65.1e-08222243122
                                   ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                                           ELK+ Llr  +++++sLk EFs
  cra_locus_53427_iso_1_len_1052_ver_3 222 ELKDKLLRRCGSHISSLKLEFS 243
                                           9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012553.2E-1991135IPR005540KNOX1
PfamPF037901.8E-2093133IPR005540KNOX1
SMARTSM012566.0E-21145193IPR005541KNOX2
PfamPF037916.8E-23146192IPR005541KNOX2
PfamPF037891.1E-5222243IPR005539ELK domain
SMARTSM011884.9E-4222243IPR005539ELK domain
PROSITE profilePS5007112.957242305IPR001356Homeobox domain
SuperFamilySSF466892.91E-19243316IPR009057Homeodomain-like
SMARTSM003895.8E-13244309IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.609.3E-28247306IPR009057Homeodomain-like
CDDcd000862.47E-13254306No hitNo description
PfamPF059208.4E-18262301IPR008422Homeobox KN domain
PROSITE patternPS000270280303IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010073Biological Processmeristem maintenance
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MDEMYGLHST GGDDYAERAL MSDPDNLIIP AVDYLQYEHP YGSMLPSDGD RRNIPVFGSE  60
DLGFQCSAAA SESVSINAHN NHGEAHAAVS TVIKSKIASH PSYPKLIDAY IDCQKVGAPP  120
EIASLLDEIR REKEFCKYRN LIPISLGTDP ELDEFMETYY DILVKYKSDL SRPFDEASSF  180
LHNIETQLGN LCKDDGALSS DDELSGGETE TPDAQTRSED RELKDKLLRR CGSHISSLKL  240
EFSKKKKKGK LPKESRQTLL EWWNVHYKWP YPTEADKISL AETTGLDQKQ INNWFINQRK  300
RHWKPSENMQ LAIMNNLSGH FFADX
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011071110.11e-157PREDICTED: homeobox protein knotted-1-like 6
SwissprotQ84JS61e-125KNAT6_ARATH; Homeobox protein knotted-1-like 6
TrEMBLA0A061EE171e-139A0A061EE17_THECC; KNOTTED1-like homeobox gene 6
STRINGVIT_01s0127g00210.t011e-134(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA7532480